<!--#set var="title" value="Isolate Data" --> <!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
206880 206880 Argentina 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115YF, M184V L74V, K219N L100I, K101E, G190A E138A, H221Y V35I, I135L, S162A, I167IV, V179I, R211RKMT, D237N, V245Q, A272P, A288S, P294T, I329L, Q334E, Y339F, R356K, I375V, T377L, T386I, K388R, A400T  
>206880| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIEKKKSVTVLDVGDAFFSVPL
DKDFRKYTAFTIPSLNNATPGIRYQYNVLPQGWKGSPAIFQASMTKVLEPFRKQNPDIII
YQYVDDLYVASDLEIGQHRTKIEELRQHLLTWGFTTPDNKYQKEPPFLWMGYELHPNKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVITLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGEGQWTFQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKVALESIVIWGKIPRFKLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, E35D, N37D, L63P, A71AT  
>206880| codons 1-99
PQITLWQRPLVPIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012