<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA799 CA9998 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 261
2 DDI 65
3 AZT+DDI 52
4 3TC+AZT 48
5 D4T+DDC+RTV 31
6 D4T+DDC+IDV 13
7 3TC+AZT+RTV+SQV 13
8 D4T+NFV+NVP 9
9 3TC+AZT+D4T+IDV 14
10 3TC+AZT+DDI+RTV+SQV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G73S L10I, I15V, K20M, E35D, M36I, R57K, I62V, L63P, A71V  
>CA9998| codons 1-99
PQITLWQRPIVTIKVGGQLMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y A62AV, D67E Y181IS A98G V35M, K43KQ, E44D, S68G, K122E, I135T, D177E, V179I, G196E, E203K, Q207E, D250E, A272P, V276I, A288S, I293V, E297K  
>CA9932| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEQDGKISKIGPENPYNTPV
FVIKKKEGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
IQYVDDLYVGSDLEIEQHRTKIKELREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKSLTEVVPLTKEAE
LE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005