<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1145 CA9977 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 39
2 IDV+ AZT+ 3TC 52
3 SQV+ RTV+ D4T+ 3TC 17
4 NFV+ NVP+ D4T+ 3TC 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84IV, L90M V11VI, G73T L10I, T12A, I15V, L19I, K20I, L63P, I64IV, A71IV, I93L  
>CA9977| codons 1-99
PQITLWQRPIIAIKVGGQIIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKIITTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219Q K101PQ, K103KN   T39A, E40F, K43E, V60I, K122E, D123E, I135T, I178M, V179I, Y181X, G196E, E203K, Q207D, H208Y, R211K, H221HY, L228H, A272P, T286A  
>CA9912| codons 1-293
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAFLEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
XQYVDDLYVGSDLEIEQHRTKIKELRDYLWKWGFYTPDQKYQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVI

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005