<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA606 CA9976 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 DDI 82
3 D4T 39
4 3TC+AZT 17
5 3TC+AZT+SQV 9
6 3TC+AZT+IDV 57
7 3TC+D4T+RTV+SQV 40
8 3TC+D4T+EFV+RTV+SQV+Unknown 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, K20I, N37D, I62V, L63P, K70R, A71AT, I72IT  
>CA9976| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHRTTSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N   K20R, A98S, K122E, A158S, Q197E, L228LH, V245E  
>CA9911| codons 1-250
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGEHRTKIEELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKD

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005