<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt5 5-1 Netherlands 2006 HIV1 B Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, K14R, V31I, A49T, Y99F, L101I, K111T, I113V, S119T, S123G, T124A, T125A, K127R, I135V, V201I, A205S, T206S, Q216K, S230N, D256E  
>5-1| codons 1-288
FLDGIEKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGETMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAFFILKLAGRWPVTTVHTDNGTN
FTGAAVRAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISSDIQTKELQKKITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Van Baelen, K Low level of baseline resistance to integrase inhibitors L731,988 and L810,810 in randomly selected subtype B and non-B HIV-1 strains. IHDRW 2007, 2007