<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt3 3-4 Netherlands 2006 HIV1 B Plasma MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6T, K7E, E10D, E11D, V31I, V32I, L101I, S119P, T122I, S123G, T125A, K127R, S230N  
>3-4| codons 1-288
FLDGITEAQDDHEKYHSNWRAMASDFNLPPIIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FIGTAVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Van Baelen, K Low level of baseline resistance to integrase inhibitors L731,988 and L810,810 in randomly selected subtype B and non-B HIV-1 strains. IHDRW 2007, 2007