<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4142 CA9956 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 NRTI NA
3 D4T 21
4 3TC+ D4T+ SQV 65
5 3TC+ D4T+ RTV 65
6 3TC+ D4T+ RTV+ SQV 12
7 AZT+ DDI+ NVP+ NFV 17
8 D4T+ DDI+ NVP+ NFV 34
9 3TC+ ABC+ D4T+ EFV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M   L10I, R41K, K55R, L63P, I64IV  
>CA9956| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYD
QIPVEICGHKAIGTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V, T215Y F77L, F116Y Y181C, G190S   T58N, S68G, K101Q, I142V, T200A, I202V, F214L, I293V, E297K  
>CA9892| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNNPV
FAIKKKDGTKWRKLVDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAFYSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVSSDLEIGQHRAKVEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005