<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA640 CA9944 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 52
2 3TC+AZT+SQV 61
3 3TC+AZT+IDV 39
4 3TC+D4T+RTV+SQV 22
5 AZT+DDI+NVP+RTV+SQV 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       D123E, I135T, I142T, D177E, V179I, G196E, L228R  
>CA9944| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFRWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V K43T L10I, G17E, N37D, L63P, C67S, A71V, V77I, I93L  
>CA10011| codons 1-99
PQITLWQRPIVTIKIGEQLKEALLDTGADDTVLEEMDLPGRWTPKMIVGIGGFVKVRQYD
QIPIEISGHKVIGTVLIGPTPANVIGRNLLTQLGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. JAIDS, 2000
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012