<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA9929 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 58
7 D4T+DDI+EFV+RTV+SQV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q   A98G V35I, T39A, K49R, L100LV, D123E, I135T, V179I, D218E  
>CA9929| codons 1-226
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGVKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L24I, G73S L10I, I13V, L63P, I72V, I93L  
>CA9995| codons 1-99
PQITLWQRPIVTVKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAVSTVLVGPTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000