<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1116 CA9893 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ AZT+ 3TC 8
2 IDV+ AZT+ 3TC 21
3 None 53
4 SQV+ RTV+ AZT+ 3TC 2
5 NFV+ DDI+ 3TC 3
6 SQV+ NFV+ DDI+ AZT 34
7 SQV+ DDI+ AZT+ 3TC 14
8 NRTI+ PI 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, V90I, K122KE, G196E, R211K  
>CA9893| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, N37H, R41K, L63PS, I72IV  
>CA9836| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMHLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005