<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
801-143188S 801 Uganda 1997 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, G17E, K20R, E35D, M36I, R41K, K45R, R57K, H69K, K70KR, L89M  
>801| codons 1-99
PQITLWQRPLVTVRIGEQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, V60I, K122E, D123N, T139K, K173L, Q174K, I178M, V179I, Q207A, R211RST, V245HKNQ, D250E, T286A, E291D, V292I, I293V, E312D  
>801| codons 1-334
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPDMII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Church, JD HIV type 1 variants with nevirapine resistance mutations are rarely detected in antiretroviral drug-naive African women with subtypes A, C, and D. ARHR, 2007