<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
708-136157U 708 Uganda 1997 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, N37D, R41K, R57RK, D60E, L63P, I64V, K70KR, I72L  
>708| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDMDLPGKWKPKMIGGIGGFIKVKQYE
QIPVEICGHRALGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D123DG, D177E, I178M, T200K, Q207E, R211K, V245HKNQ, D250E, A272P, I274IV, K275R, L282C, R284RK, T286A, I293V, E297K, I309IL, V317VA  
>708| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRKKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGVRVKQLCKCLKGAKALTEVVPLTKEAE
LELAENRELLKEPVHGAYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Church, JD HIV type 1 variants with nevirapine resistance mutations are rarely detected in antiretroviral drug-naive African women with subtypes A, C, and D. ARHR, 2007