<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
515-128487Q 515 Uganda 1997 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, N37NT, R41K, L63Q, I64V, E65D  
>515| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QIQVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28EG, V35T, K49R, E53ED, V60I, K122E, K173KQ, D177DE, I178M, E194D, Q207G, R211K, D250E, I257L, A272P, K277R, L282C, I293V  
>515| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTGEKIKALTEICTEMEKEGKISRIGPDNPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPEMVI
YQYMDDLYVGSDLDIGQHRTKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDLQKLVGKLNWASQIYPGIKVRQLCKCLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Church, JD HIV type 1 variants with nevirapine resistance mutations are rarely detected in antiretroviral drug-naive African women with subtypes A, C, and D. ARHR, 2007