<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
494-127521w 494 Uganda 1997 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16A, R41K, D60E, L63P, C67S  
>494| codons 1-99
PQITLWQRPLVTVKIAGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QIPIEISGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11KR, V35T, E40D, K49R, V60I, K122E, D123DEG, I135RT, T139TA, D177E, I178IM, T200I, I202IV, Q207EG, R211K, V245Q, A272P, K277R, L282C, T286A, A288AG, I293V, K311KR  
>494| codons 1-334
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKVEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGAKGLTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Church, JD HIV type 1 variants with nevirapine resistance mutations are rarely detected in antiretroviral drug-naive African women with subtypes A, C, and D. ARHR, 2007