<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
487-126068K 487 Uganda 1997 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, R41K, R57K, E65D, H69K, L89M  
>487| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V21I, V35T, T39R, V60I, K122KE, D123S, I135T, K173S, D177E, V179I, I202IV, Q207A, R211S, V245Q, E248N, T286A, E291D, V292I, I293V, P294T, E312D, V317VA, I326T  
>487| codons 1-334
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGAYYDPSKDLTAEIQKQGQ

References
Author Title Citation
Church, JD HIV type 1 variants with nevirapine resistance mutations are rarely detected in antiretroviral drug-naive African women with subtypes A, C, and D. ARHR, 2007