<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1446 CA9848 U.S. 1998 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+DDI 8
3 3TC+D4T+IDV 22
4 NFV+NVP+SQV 35
5 None 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82T, L90M L10F M36I, N37D, R57K, L63P, A71V, L89M, I93L  
>CA9848| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEIDLPGRWKPKIIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MV, L210W, T215Y       V35VI, R83K, E169D, T200TA, H208Y, R211K, K287X, I293V  
>CA9849| codons 1-295
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTXALTEVVPL

References
Author Title Citation
Palmer, S Highly drug-resistant HIV-1 clinical isolates are cross-resistant to many antiretroviral compounds in current clinical development. AIDS, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005