<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1450 CA9839 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 DDI+ AZT 9
3 AZT 27
4 DDC+ AZT 43
5 DDI+ AZT 8
6 AZT+ 3TC 23
7 SQV+ AZT+ 3TC 55
8 NFV+ D4T+ 3TC 23
9 NFV+ 3TC+ D4T 31
10 None 17
11 NFV+ D4T+ 3TC 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14R, I15V, E35D, H69Q, V82I  
>CA9839| codons 1-99
PQITLWQRPIVTIRVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, V106I, K122E, I135T, F214L, I293V, E297T  
>CA9438| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTTEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005