<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAR-38 CAR-38 Central African Republic 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20R, E35D, M36I, N37D, R41K, K45R, R57K, E65D, H69K, L89M  
>CAR-38| codons 1-99
PQITLWQRPLVTVRVGGQLREALLDTGADDTVLEDIDLPGKWKPRMIGGIGGFIKVKQYD
QILIDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Punzi, G HIV infection and protease genetic diversity in a rural area of the Southern Central African Republic. J Med Virol, 2005