<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4128 CA9834 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 13
2 3TC+D4T 44
3 3TC+D4T+IDV 26
4 3TC+D4T+NFV 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, K20T, L33V, I64V, A71V  
>CA9834| codons 1-99
PQITLWQRPLVTVKIGGQLTEALLDTGADNTVVEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001