<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1487 CA9833 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 47
2 DDI 33
3 D4T 9
4 3TC+AZT 9
5 3TC+D4T 8
6 3TC+DDI 20
7 3TC+DDI+IDV 31
8 3TC+D4T+RTV+SQV 67
9 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62V, L63Q  
>CA9833| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVQIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K122E, T200I, R211K, A272P, K277R, I293V, E297K  
>CA9433| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005