<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4115 CA9823 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT 13
3 3TC+AZT+IDV 104
4 3TC+D4T+IDV 26
5 3TC+EFV+SQV 21
6 D4T+RTV+SQV 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M K43T I13V, L63P, I64V, I72V, V77I  
>CA9823| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIGGIGGFIKVRQYD
QIPVEICGHKAVGTVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   L100LI, K101KE, K103N   K20R, V35L, K43KE, A98S, K122E, E138A, G190X, G196E, I293V  
>CA9420| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGIEKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVXSDLEIEQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005