<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2205 CA9809 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36L, N37A, I62V, L63P, I64V, I72V  
>CA9809| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEELALPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V       V35M, K102Q, K103R, K122E, Q174KR, T200I, I202V, V245M, A272S, L283I, T286A, A288AS, I293V P150PL
>CA9398| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLLQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYVDDLYVGSDLEIGQHRIKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLIRGAKSLTEVVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005