<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4101 CA9785 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 Unknown 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, V11VF, E35D, N37H, R41K, K55R, R57K, I62V, L63P, A71V, V77T, I93L  
>CA9785| codons 1-99
PQITLWQRPIFTIKIGGQLKEALLDTGADDTVLEDMHLPGKWKPKIIGGIGGFIRVKQYD
QVPIEICGHKVISTVLTGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   L100LI, K103N   K20R, T39K, K43E, E44D, V118I, K122E, E203K, Q207E, H208Y, R211K, K223Q, V241VM, R284K, T286A, I293V  
>CA9396| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
MQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001