<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW098 SW098 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+EFV 340

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, K219E L100I, K103N   V60I, T69TN, K122E, D123G, K173A, Q174K, D177E, T200E, I202V, Q207E, R211K, F214L, V245Q  
>SW098| codons 40-247
EMEKEGKISKIGPENPYNTPIFAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAG
IKKNKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRAKNPEIVIYQYMDDLYVGSDLEIGQHREKVEELREHLLKWGLTTPDE
KHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, R41K, H69K, L89M, I93L  
>SW098| codons 4-99
TLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008