<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW089 SW089 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 72

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V   K101E, G190A   V60I, W88C, K122E, D123G, K173A, D177E, T200A, Q207E, R211K, V245E E44EV
>SW089| codons 40-247
ELEKVGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAG
LEKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRAQNPEIVIYQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI   T12S, I15V, L19V, M36I, R41K, L63S, H69K, L89M, I93L, N98K  
>SW089| codons 7-99
QRPLVSIKVGGQVKEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYDQISIEI
CGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLKF

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008