<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4078 CA9778 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 117
2 3TC+AZT+NFV 35
3 3TC+AZT+NFV+NVP 17
4 3TC+AZT+NVP+RTV+SQV 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V F53L L10I, K20KR, E35D, M36I, N37D, D60E, I62V, L63P, G68E, H69Q, A71V, I93L  
>CA9778| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGLVKVRQYE
QVPIEICEQKVIGTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70KR, M184V, T215F K219Q K103S, G190GA   I178M, H208Y, R211K  
>CA9364| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVASDLEIGQHRTKIEELRQYLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001