<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW056 sw056 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, G190GA   S48T, V60I, T69TN, W88C, K122E, D123G, K173T, T200A, Q207D, R211K, V245E  
>sw056| codons 40-246
EMEKEGKITKIGPENPYNTPIFAIKKKDSNKWRKLVDFRELNKRTQDFCEVQLGIPHPAG
LKKNKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRTQNPDIVIYQYMDDLYVASDLEIGQHRAKIEELRDHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQPIEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, H69K, I93L  
>sw056| codons 4-99
TLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008