<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW055 sw055 South Africa 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA
2 AZT+DDI+LPV 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, K20R, E35D, M36I, R41K, H69K, I72M, T74S, L89M, I93L  
>sw055| codons 4-99
TLWQRPLVSIKVGGQTREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAMGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179VD S48T, K102R, D123E, K173T, Q174K, Q197P, T200A, Q207E, R211K, P243T, V245Q  
>sw055| codons 40-247
EMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKRKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRTKNPDIDIYQYMDDLYVGSDLEIGPHRAKIEELREHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQTIQLP

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008