<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW054 sw054 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33LF T12S, L19I, E35ED, N37NS, R41K, Q61N, L63A, H69K, L89M, I93L  
>sw054| codons 4-99
TLWQRPLVSIKIGGQIKEALLDTGADDTVFEDMSLPGKWKPKMIGGIGGFIKVRQYDNIA
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   K103N A98G, P225H S48T, V60VI, S68SG, K101KQ, I135L, K173A, D177E, I178M, T200A, E203ED, Q207A, H208HY, R211K, H221HY, V245Q K49KI
>sw054| codons 40-247
ELEKEGKITIIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGG
LQKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRAQNPEMVIYQYVDDLYVGSDLEIGQHRAKIDELRAYLLKWGFYTPDK
KYQKEHPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008