<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SW049 sw049 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 52
2 3TC+D4T+EFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75M K103N, Y181YC, G190A A98G E44D, S48T, V60I, V118I, K122E, D123N, T139K, A158AS, S162G, K173A, Q174K, N175Y, D177E, I178M, T200A, Q207E, R211RK, D218DE, V245Q  
>sw049| codons 40-247
ELEKDGKITKIGPENPYNTPIFAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPGG
LKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPSI
FQGSMTKILEPFRAKYPEMVICQYVDDLYVASDLEIGQHRAKIEELREHLWKWGFYTPEK
KHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, M36I, R41K, H69K, T74S, L89M, I93L  
>sw049| codons 4-99
TLWQRPLVTIKIGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008