<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4057 CA9770 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 3TC+AZT+IDV 22
3 3TC+ABC+ADV+APV+Unknown 31
4 3TC+APV+Unknown 168

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L89V L10I, I13V, K20M, M36I, L63P, A71V, I93L  
>CA9770| codons 1-99
PQITLWQRPIVTVKIGGQLMEALIDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNVLTQLGCTLNF

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005