<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1480 CA9765 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+ AZT 24
3 AZT+ 3TC+ IDV 14
4 AZT+ 3TC+ SQV 57
5 DDI+ NVP+ NFV 23
6 D4T+ DDI+ RTV+ SQV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M F53FL, Q58E, T74P L10I, K20M, E35ED, M36I, R41K, K55R, I62V, L63A, A71V, I93L  
>CA9765| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEDINLPGKWKPKIIGGIGGLIRVREYD
QVAIEICGHKVIGPVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181C   V21I, K101X, K122KE, I178M, R211K, L228R  
>CA9331| codons 1-250
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLXKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005