<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1499 CA9764 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 44
2 DDI 126
3 D4T 52
4 3TC+D4T 65
5 3TC+D4T+IDV 58
6 D4T+NFV+NVP 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S E35D, N37Q, I62V, L63P, A71V, V77I, I93L  
>CA9764| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMQLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   Y181C, G190A   K20R, V35M, T39A, K43E, E44ED, V118I, D123E, D177E, E194X, G196E, E203K, Q207E, H208Y, R211EK, K223Q  
>CA9320| codons 1-247
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLXIEQHRTKIKELREYLWEWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005