<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ICH20 ICH20 South Africa 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, R57K, L63Q, H69K, T74S, L89M, I93L W6V
>ICH20| codons 4-99
TLVQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIQ
IEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KE, M184V   K103N V108VI E40D, S48T, V60I, S68G, K122E, D123G, I135T, K173A, Q174K, D177E, T200A, Q207E, R211K  
>ICH20| codons 40-241
DMEKEGKITKIGPENPYNTPIFAIKKKDGTEWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKNKSVTILDVGDAYFSVPLDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRAKNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDK
KHQKEPPFLWMGYELHPDKWTV

References
Author Title Citation
Marconi, VC Prevalence of HIV-1 drug resistance after failure of a first highly active antiretroviral therapy regimen in KwaZulu Natal, South Africa. Clin Infect Dis, 2008