<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4035 CA9748 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 28
2 AZT+DDI 14
3 3TC+AZT 9
4 3TC+AZT+RTV 35
5 3TC+D4T 49
6 3TC+D4T+NFV 42
7 Unknown 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, E35D, M36V, N37Y, R41K, I62V, L63T, A71V, I72V, I93L  
>CA9748| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEDVYLPGKWKPKMIGGIGGFIKVRQYD
QVTIEICGHKVVGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   L100LI, K103N   K20R, A98AS, K101R, K122E, I135IT, I142IT, K173Q, Q174K, D177E, T200TA, Q207E, R211K  
>CA9298| codons 1-252
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGIRKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005