<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3971 CA9740 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+AZT 30
3 3TC+DDI+SQV 26
4 3TC+DDI+IDV 79

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F, G73C K20I, I62V, L63P, C67CF, H69Q, V77IL  
>CA9740| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEIFGQKAICTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, M184V       E6D, V35I, I135T, K166R, K173KE, T200IV, R211RK, K277R, R284K, T286A, I293V  
>CA9214| codons 1-304
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTGWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKALTEVVPLTEEAE
LELA

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005