<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1494 CA9734 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 DDI 6
3 3TC+AZT+IDV 8
4 3TC+D4T+RTV 45
5 3TC+D4T+NFV 12
6 3TC+D4T+RTV+SQV 19
7 3TC+DDI+NFV+RTV 23
8 D4T+RTV+SQV 27
9 EFV+RTV+SQV 6
10 3TC+APV+DDI+EFV+NFV 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M   L10I, R57K, L63P, A71V, T74S, V77I, I93L  
>CA9734| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVKQYD
QIPIEICGHKVIGSVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q K101E, Y181YC, G190S   P4S, K20R, V60I, K122E, D177E, I178M, Q207E, V245E, A272P, K277R, I293V, E297Q  
>CA9211| codons 1-303
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
CQYMDDLYVSSDLEIGQHRTKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTQEAE
LEL

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005