<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1534 CA9712 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+DDC 170
3 AZT 57
4 3TC+AZT 17
5 3TC+AZT+IDV 96
6 DLV+NFV+SQV 21
7 D4T+DDI+RTV+SQV 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48GV, L90M F53FL, G73C L10I, D60E, I62V, L63P, I64V, K70R, I72E, V77I, I93L  
>CA9712| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGLIKVRQYE
QVPVEICGHRAECTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y181C A98G T39N, K43E, V118I, K122P, D177E, V179I, E203EK, Q207E, R211K, L228LH, Q278H, T286A, E291D, V292I, I293V  
>CA9184| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
CQYMDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTDIVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005