<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3937 CA9709 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 35
2 3TC+AZT 9
3 3TC+AZT+SQV 4
4 3TC+AZT+RTV 65
5 DDI+NFV+NVP 91

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82IM, L90M K43T I15IV, K20R, E35D, M36I, L63P, I64V, T74TS, I93L  
>CA9709| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTILEDINLPGRWTPKIIGGIGGFVKVRQYD
QIPVEICGHKAIGSVLVGPTPINIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V, L210LW, T215Y   K101E, Y181C, G190A   V21I, T27X, M41MI, K43KR, V60I, K122P, I135T, E138A, I142IV, S162C, Q207E, H221HY, L228LR, A272P, K277KR, T286A, E297K  
>CA9147| codons 1-303
PISPIETVPVKLKPGMDGPKIKQWPLXEEKIKALVEICTEIEREGKISKIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELREHLWRWGFYTPDKKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005