<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3920 CA9693 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 72
2 AZT+DDC 134
3 3TC+D4T 36
4 3TC+AZT+IDV 16
5 3TC+AZT+NFV 46
6 NVP+3TC+D4T+NFV 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, N37CS, L63P, I64V, A71V, V77I  
>CA9693| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMCLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKVIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TAIV, K219Q K103KN, V106VA, Y181YC, G190GA   V35M, I135IM, K166R, V179VI, G196E, Q197K, F214FL, D218E, D237DN, V245T, E248D  
>CA37718| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIII
CQYVDDLYVASDLEIEKHRTKIEELRQHLLRWGLVTPEQKHQKEPPFLWMGYELHPNKWT
VQPITLPDK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009