<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4068 CA9692 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+DDC 55
3 DDI 6
4 D4T 37
5 3TC+D4T 25
6 3TC+AZT 5
7 3TC+AZT+SQV 28
8 3TC+AZT+IDV 8
9 3TC+D4T+IDV 23
10 3TC+D4T+RTV+SQV 2
11 3TC+D4T+IDV 9
12 3TC+D4T+NFV 5
13 3TC+IDV+NVP 47
14 3TC+NVP+RTV+SQV 39
15 3TC+RTV+D4T+SQV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M F53L, G73S L10V, N37T, K55R, L63P, C67F, A71V, V77I, C95L  
>CA9692| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKLIGGIGGLIRVRQYD
QIPIEIFGHKVISTVLIGPTPVNIIGRNLMTQIGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, V75M, M184V, L210W, T215Y K219Q K103T, M230L K238T T39A, V60I, L109M, V118I, K122E, I142V, E203K, Q207E, H208Y, R211K, D218E, L228H, K277R, T286A L187M
>CA9336| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKVMDFRELNKRTQDFWEVQLGIPHPAGLKKTKSVTVMDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDMYVGSDLEIGQHRTKIKELREYLWKWGFYTPEQKHQKEPPFHWLGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005