<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1813 CA9691 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 112
2 AZT+ 3TC 56
3 3TC+ D4T+ IDV 34
4 IDV+ DDI+ DLV+ 3TC 29
5 SQV+ RTV+ DDI+ 3TC 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, N88S, L90M   L10V, I13V, I15V, K20M, E35D, M36I, I62V, L63P, A71T, I93L  
>CA9691| codons 1-99
PQITLWQRPVVTVKVGGQLMEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, L210W, T215Y V75M, K219Q K103N   V60I, K102KR, V118I, K122KE, I135T, H208Y, R211K, F214L, D218E, L228H, R284K, T286A, I293V, E297K  
>CA9124| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGLYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTKEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005