<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1437 CA9688 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 95
2 3TC+AZT 74
3 3TC+AZT+IDV 15
4 3TC+DDI+IDV 17
5 D4T+DDC+SQV 18
6 D4T+DDI+SQV 5
7 3TC+DDI+SQV 32
8 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V   L10I, K20KR, E35D, M36I, I62V, L63P, A71T, V77I, I93L  
>CA9688| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLIGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184MV, T215F K219Q L100LI, Y188L   V35VL, T39E, R83K, K173KE, I178L, Q207E, A272P, K277R, T286A, E297K  
>CA9114| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKKTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDLVI
YQYVDDLLVGSDLEIGQHRTKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005