<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1820 CA9674 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 AZT+DDC 57
3 AZT+D4T 18
4 3TC+AZT 34
5 3TC+D4T 98
6 DLV+NFV+SQV 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, R57K, L63H, I72V  
>CA9674| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIHIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39A, V60I, T139R, I142T, Y181*, Q207E, R211K, A272P  
>CA9095| codons 1-283
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNERPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
*QYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005