<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3870 CA9651 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI NA
2 3TC+D4T+SQV 52
3 Unknown 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M G73T L10I, L19I, N37T, D60E, L63P, I64V, A71V, V77I, I93L  
>CA9651| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFVKVRQYE
QIPVEICGHKVITTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215Y   K103KN, V106VA, Y181C, G190A A98G, F227L E6K, M16V, T39A, K43Q, E44D, L109I, V118I, K122E, S162X, G196E, T200I, E203K, Q207E, H208Y, R211K, H221Y  
>CA9046| codons 1-264
PISPIKTVPVKLKPGVDGPKVKQWPLTEEKIKALVEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKNKSATVIDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIEQHRIKIKELREYLWKWGFYTPDKKYQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005