Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA3871 | CA9643 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI | 13 |
| 2 | AZT+DDC | 92 |
| 3 | 3TC+AZT+SQV | 16 |
| 4 | 3TC+D4T+IDV | 142 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54A, V82F | L10I, I13V, K14R, I15V, K20M, M36V, N37T, I62V, I64V, A71V, L89I |
| >CA9643| codons 1-99 PQITLWQRPIVTVRVGGQLMEALLDTGADDTVLEEVTLPGRWKPKMIGGIGGFAKVRQYD QVLVEICGHKVIGTVLVGPTPFNIIGRNILTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |