<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3891 CA9641 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 DDI 60
3 D4T 26
4 AZT 8
5 3TC+D4T 17
6 3TC+AZT+RTV 13
7 3TC+AZT+IDV 35
8 3TC+D4T+IDV 25
9 D4T+DDC+NFV 52
10 ABC+EFV+RTV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, V11VA, I15V, K20R, E35D, M36I, N37D, L63T, I72V  
>CA9641| codons 1-99
PQITLWQRPVATIKVGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   I135T, R211K, V245K L234LH
>CA9083| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIKLPEKDSWTVNDIQKLV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005