<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 4_W8 France 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA
2 RAL 8

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, A21T, A23V, D25E, E157Q, V201I  
>4_W8| codons 1-288
FLDGIDKAQEDHEKYHSNWRTMVSEFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKQLKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Malet, I Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. AAC, 2008