<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3 3_D0 France 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    R20K, A23V, I72V, T124A, I204V, T206S  
>3_D0| codons 1-288
FLDGIDKAQEEHEKYHSNWKAMVSDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIVASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Malet, I Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. AAC, 2008