<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SGO-73 SGO-73 Mali 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F L10V, I13V, K14R, G16E, K20R, M36I, N37E, P39S, R41K, R57K, L63A, E65D, H69Q, L89M, I93L  
>SGO-73| codons 1-99
PQITLWQRPVVTVRIEGQLREALLDTGADDTVFEEIELSGKWKPKMIGGIGGFIKVKQYD
QIAIDICGQKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27P, V35T, V60I, A98S, K122E, I135V, S162A, K173T, Q174R, D177E, I178L, L193F, T200A, Q207E, R211K D121S
>SGO-73| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLPEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
SEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPELVI
YQYMDDLYVGSDFEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Derache, A Evolution of genetic diversity and drug resistance mutations in HIV-1 among untreated patients from Mali between 2005 and 2006. J Antimicrob Chemother, 2008